Skip to main content

Table 2 Development of X4 variants causing tropism switch

From: Structure of HIV-1 quasi-species as early indicator for switches of co-receptor tropism

Patient Variant Fraction of population at
   time 1 time 2 time 3
07 CTRPGNNTRRSIRIGPGQTFFAREDIIGDIRQAYC 0.01 0.07 0.73
18 CERPNNNTRQRLSIGPGRSFYTSRRIIGDVKKAHC 0.005 0.79 0.71
19 CTRPNNNTRKGIYLGPGRAFYTTDKIIGDIRQAHC 0.007 0.43 0.08
47 CTRPNNSTRKSINIGPGSAWYTTGDIIGDIRQAHC 0.0009 0.0 0.0
  1. Development of the X4 seed strains in Subjects 07, 18, 19 with tropism switches and the largest initial X4 strain in patient 47 who does not show a tropism switch. The three times are the sampling points along the "Time" axis in Figure 1.